PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G005640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family NAC
Protein Properties Length: 353aa    MW: 40657.2 Da    PI: 7.0135
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G005640.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.84.2e-5351331128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPt+eelv +yLk+k+++ k++l +vi ++d+yk+ePwd+++     + e++ewyfFs++dkky+tg+r+nrat++g+Wkat
  HL.SW.v1.0.G005640.1   5 VPPGFRFHPTEEELVGYYLKRKINALKIDL-DVIIDIDLYKIEPWDIQArcnLGYDEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKAT 92 
                           69****************************.99**************953432233677****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           g+dk+v+s k++ +g++ktLvfykgrap+g+k+dW+mheyrl
  HL.SW.v1.0.G005640.1  93 GRDKAVFS-KNRMIGMRKTLVFYKGRAPNGRKSDWIMHEYRL 133
                           ********.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-593153IPR003441NAC domain
PROSITE profilePS5100557.6585153IPR003441NAC domain
PfamPF023652.4E-286133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MESCVPPGFR FHPTEEELVG YYLKRKINAL KIDLDVIIDI DLYKIEPWDI QARCNLGYDE  60
QNEWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAVFS KNRMIGMRKT LVFYKGRAPN  120
GRKSDWIMHE YRLQTSEHAP PQARWVVCRA FRKPSPSHHQ RQGCEMWNHA NYYVRENSNN  180
MRQLPYCSSA DFVEEKHNNM QANHPNLAAT AFHNCFPPSA HEELVVSTTN HSLVDHIQLT  240
HELLPQLDSP SISANLATND QSFQHNSTTN ILNDHDNYDN NEIRSNISST STGTSASQYI  300
DWKNLDSFLS SQLSTDPITS FVASDNLPPL VPQNYRQENL NHHYFGCFPD QL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-48215312168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094969.11e-157NAC domain-containing protein 7
SwissprotQ9C8W91e-110NAC30_ARATH; NAC domain-containing protein 30
TrEMBLW9QY051e-157W9QY05_9R
STRINGGLYMA10G36050.21e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-92vascular related NAC-domain protein 7